« Zurück
Startseite /
HCLS1 Antibody - N-terminal region

HCLS1 Antibody - N-terminal region

ArtNr	ARP31928_T100
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Neural Transcription Factors Molecular Targets for Neuroscience Aging & Neurological Disorders Neural Epigenetics Antibodies By Cell Type Hematology Lymphoma Myeloma Melanoma Immunohistochemistry Western Blot Primary Antibodies By Organ Heart & Blood Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Citations	Ruzzene,M., et al., (2002) Biochem. J. 364 (Pt 1), 41-47
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HS1,p75,CTTNL,lckBP1
Similar products	HCLS1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	54kDa
Species Tested	Human, Mouse
Gene symbol	HCLS1
Gene Fullname	Hematopoietic cell-specific Lyn substrate 1
Protein size	486
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SH2D4A; UBC; Mbp; Dlg4; NOTCH1; QKI; TERF1; TRIM29; SSBP3; BLZF1; IKBKG; LZTR1; ZBTB25; HS1BP3; HAX1; ACTR2; MAP4K1; CASP3; SYK; WAS; LYN; FGR; CSNK2A1; CD79A; ACTA1; GRB2; ACTR3;
Description of target	HCLS1 Tyr phosphorylation catalyzed by Syk and Lyn plays a crucial role in the translocation of the protein to the membrane and is involved in the cytoskeleton rearrangement triggered by thrombin in human platelets. This gene is a substrate for caspase cleavage during apoptosis.
Nucleotide accession_num	NM_005335
Protein accession_num	NP_005326
Protein name	Hematopoietic lineage cell-specific protein
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
Homology	Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Concentration	1.0 mg/ml
Sample Type Confirmation	HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern