« Zurück
Startseite /
Gfap Antibody - N-terminal region

Gfap Antibody - N-terminal region

ArtNr	ARP54621_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Blastoma Immunohistochemistry Western Blot Primary Antibodies Neurodegeneration Markers Microglia Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	AI836096
Similar products	Gfap
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Neuroscience, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	46kDa
Species Tested	Human, Mouse
Gene symbol	GFAP
Gene Fullname	Glial fibrillary acidic protein
Protein size	418
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Kcnma1; Myo5a; Nphp4; Ywhaz; Pou5f1; Ubc; Ncor1; Stat1; Nr2e1;
Description of target	GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
Nucleotide accession_num	NM_010277
Protein accession_num	NP_034407
Protein name	Glial fibrillary acidic protein
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern