« Zurück
Startseite /
ELAVL4 Antibody - N-terminal region

ELAVL4 Antibody - N-terminal region

ArtNr	ARP40971_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Neural Transcription Factors Molecular Targets for Neuroscience Neural Signaling Antibodies By Cell Type Carcinoma Hematology Lymphoma Melanoma Sarcoma Cell Biology Cell Status Apoptosis Western Blot Senescence Primary Antibodies By Organ Lung Cancer Bladder Cancer Neuronal Cell Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
Citations	Ratti,A., (2008) J. Biol. Chem. 283 (12), 7531-7541
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HUD,PNEM
Similar products	ELAVL4
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	42kDa
Species Tested	Human
Gene symbol	ELAVL4
Gene Fullname	ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
Protein size	380
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	PHF20L1; UBC; SUMO1; NFX1; ELAVL2; GAP43; EWSR1; NXF1;
Description of target	ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
Nucleotide accession_num	NM_021952
Protein accession_num	NP_068771
Protein name	ELAV-like protein 4
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ELAVL4
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern