« Zurück
Startseite /
MED16 Antibody - C-terminal region

MED16 Antibody - C-terminal region

ArtNr	ARP57927_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Neural Development Neural Adhesion Molecules Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Western Blot Primary Antibodies By Organ Bladder Cancer Calcium Binding Protein Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host	Rabbit
Sequence	MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS
Citations	Sato,S., (2004) Mol. Cell 14 (5), 685-691
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DRIP92,THRAP5,TRAP95
Similar products	MED16
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	97kDa
Species Tested	Human
Gene symbol	MED16
Gene Fullname	Mediator complex subunit 16
Protein size	877
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	HECW2; CDK19; CDK8; UBC; MED19; MED26; EPAS1; FBXW7; MED11; MED8; MED29; MED9; MED18; MED4; RALY; MED13; MED12; MED24; MED21; MED14; MED1; CTDP1; HIST1H3A; MED10; MED25; MED15; VDR; TRA; MED28; OBFC1; ZC3H13; QKI; TADA2A; SUPT7L; SUPT3H; MYC; KAT2A; TRRAP
Description of target	THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Subunit	16
Nucleotide accession_num	NM_005481
Protein accession_num	NP_005472
Protein name	Mediator of RNA polymerase II transcription subunit 16
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human MED16
Homology	Cow: 92%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 92%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern