Esrrg antibody - middle region (ARP32261_P050)

Hersteller AVIVA Systems Biology
Kategorie
Typ Antibody Polyclonal
Specific against Human, Mouse, Rat, Porcine, Rabbit, Fish, Guinea Pig, Bovine, Canine, Equine
Format Lyophilized powder
Applikationen WB
Menge 50ug
Host Rabbit
ArtNr ARP32261_P050
Eclass 6.1 32160702
Eclass 9.0 32160702
Lieferbar
Description
This is a rabbit polyclonal antibody against Esrrg. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (infohoelzel.de).
Short description
Receive a free blocking peptide (/sd/pep/peptide_datasheet.php?sku=AAPP03242'>AAPP03242 when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Gene symbol
Esrrg
Alias symbols
errg, Esrrg
Protein size
458
Molecular weight
51kDa
Gene_id
360896
Peptide Sequence
RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPE KIYAMPDPTVPDSDI
Reconstitution and storage
Add 50 ul of distilled water. Final anti-Esrrg antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Description of target
Esrrg is an orphan receptor that acts as transcription activator in the absence of bound ligand. It binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
Homology short
Bovine, Chicken, Dog, Guinea pig, Human, Mouse, Pig, Rabbit, Zebrafish
Immunogen
The immunogen for anti-Esrrg antibody: synthetic peptide corresponding to a region of Rat
Menge: 50ug
Lieferbar: In stock
Listenpreis: 311,54 €
Preis: 311,54 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?

Ihr Ansprechpartner:

Arne Pelz

sales@hoelzel.de

 
Schließen