« Zurück
Startseite /
NEK1 (NIMA (never in mitosis gene a)-related kinase 1) Antibody (against the middle region of NEK1) (50ug)

NEK1 (NIMA (never in mitosis gene a)-related kinase 1) Antibody (against the middle region of NEK1) (50ug)

ArtNr	ARP48734_P050
Hersteller	AVIVA Systems Biology
Menge	50ug
Kategorie	Oncology Infectious Diseases Viral Infections Coronavirus (COVID-19) Antibodies Western Blot Primary Antibodies By Organ Colorectal Cancer
Typ	Antibody Polyclonal
Format	Lyophilized powder
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DKFZp686D06121, DKFZp686K12169, KIAA1901, MGC138800, NY-REN-55, SRPS2
Similar products	NEK1
Lieferbar
description	This is a rabbit polyclonal antibody against NEK1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (infoavivasysbio.com).
gene_symbol	NEK1
nucleotide_accession_num	http://www.ncbi.nlm.nih.gov/nuccore/NM_012224
protein_accession_num	http://www.ncbi.nlm.nih.gov/protein/NP_036356
swissprot_id	http://www.uniprot.org/uniprot/Q96PY6
protein_size	1258
molecular_weight	143kDa
Observed Species Reactivity	Human
product_format	Lyophilized powder
gene_id	4750
peptide_sequence	ETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSE
reconstitution_and_storage	Add 50 ul of distilled water. Final anti-NEK1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
partner_proteins	C14orf1, C2orf18, C9orf9, CRMP1, GBP2, IGSF21, SAT1, SEPHS1, UNC119, C14orf1, C2orf18, C9orf9, CRMP1, GBP2, IGSF21, SAT1, SEPHS1, UNC119
description_of_target	NEK1 phosphorylates serines and threonines, but also appears to possess tyrosine kinase activity. NEK1 is implicated in the control of meiosis.
clonality	Polyclonal
immunogen	Synthetic peptide directed towards the middle region of human NEK1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern