« Zurück
Startseite /
NAPSA Antibody - middle region

NAPSA Antibody - middle region

ArtNr	ARP64545_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Western Blot Cardiovascular Research Heart Failure Hypertension Primary Antibodies By Organ Lung Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	SVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYI
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KAP,Kdap,NAP1,NAPA,SNAPA
Similar products	NAPSA
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	39kDa
Species Tested	Human
Gene symbol	NAPSA
Gene Fullname	Napsin A aspartic peptidase
Protein size	420
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC;
Description of target	The activation peptides of aspartic proteinases plays role as inhibitors of the active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The pronapsin A gene is expressed predominantly in lung and kidney. Its translation product is predicted to be a fully functional, glycosylated aspartic proteinase precursor containing an RGD motif and an additional 18 residues at its C-terminus.
Nucleotide accession_num	NM_004851
Protein accession_num	NP_004842
Protein name	Napsin-A
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 80%; Pig: 86%; Rat: 79%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern