Vergleich

CEP57 Antibody - middle region

ArtNr ARP66337_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens)
Host Rabbit
Sequence TIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYM
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias MVA2,PIG8,TSP57
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
29 kDa
Species Tested
Human
Gene symbol
CEP57
Protein size
270
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerization, and the C-terminal half is required for nucleating, bundling and anchoring microtubules to the centrosomes. This protein specifically interacts with fibroblast growth factor 2 (FGF2), sorting nexin 6, Ran-binding protein M and the kinesins KIF3A and KIF3B, and thus mediates the nuclear translocation and mitogenic activity of the FGF2. It also interacts with cyclin D1 and controls nucleocytoplasmic distribution of the cyclin D1 in quiescent cells. This protein is crucial for maintaining correct chromosomal number during cell division. Mutations in this gene cause mosaic variegated aneuploidy syndrome, a rare autosomal recessive disorder. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CEP57
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen