« Zurück
Startseite /
DHRS12 Antibody - middle region

DHRS12 Antibody - middle region

ArtNr	ARP70141_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Neuroscience Targets for Rodent Neurosciences Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL
Protein Familie	H3F3A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SDR40C1
Similar products	SDR40C1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	30kDa
Species Tested	Human
Gene symbol	DHRS12
Protein size	271
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	H3F3A;
Description of target	This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46, 000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms.
Nucleotide accession_num	NM_024705
Protein accession_num	NP_078981
Protein name	Dehydrogenase/reductase SDR family member 12
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human DHRS12
Homology	Cow: 100%; Human: 100%; Zebrafish: 93%
Concentration	0.5 mg/ml
Sample Type Confirmation	DHRS12 is supported by BioGPS gene expression data to be expressed in A549

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 14 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern