Vergleich

PRKACA Antibody - N-terminal region

ArtNr ARP74754_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens)
Host Rabbit
Sequence KGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CAFD1,PKACA,PPNAD4
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cancer, Root Catalog/Products/Polyclonal Antibodies/Protein Kinases, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Tissue Specific & Cell Marker, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
39 kDa
Species Tested
Human
Gene symbol
PRKACA
Gene Fullname
protein kinase cAMP-activated catalytic subunit alpha
Protein size
351
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms.
Nucleotide accession_num
NM_001304349.1
Protein accession_num
NP_001291278.1
Protein name
cAMP-dependent protein kinase catalytic subunit alpha
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen