« Zurück
Startseite /
KHSRP Antibody - middle region

KHSRP Antibody - middle region

ArtNr	ARP76779_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Antibodies Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer Neuronal Cell Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	CPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGN
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	p75,FBP2,KSRP,FUBP2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	73 kDa
Species Tested	Human
Gene symbol	KHSRP
Gene Fullname	KH-type splicing regulatory protein
Protein size	167
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).[supplied by OMIM, Apr 2010]
Nucleotide accession_num	NM_003685.2
Protein accession_num	NP_003676.2
Protein name	far upstream element-binding protein 2
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human KHSRP
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern