« Zurück
Startseite /
SYTL2 Antibody - middle region

SYTL2 Antibody - middle region

ArtNr	ARP77446_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies Cell Biology Cytoskeleton Flow Cytometry Immunohistochemistry Western Blot Primary Antibodies By Organ Breast Cancer small GTPases Rab Subfamily
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	APIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	EXO4,SLP2,SLP2A,SGA72M,CHR11SYT,PPP1R151
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cancer, Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	82 kDa
Species Tested	Human
Gene symbol	SYTL2
Gene Fullname	synaptotagmin like 2
Protein size	752
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein name	synaptotagmin-like protein 2
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human SYTL2
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern