« Zurück
Startseite /
ATG14 Antibody - middle region

ATG14 Antibody - middle region

ArtNr	ARP81263_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Cell Biology Cell Status Western Blot Autophagy Cardiovascular Research Myocardial Infarction Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	NEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ATG14L,BARKOR,KIAA0831
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Protein Kinases, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	54 kDa
Species Tested	Human
Gene symbol	ATG14
Gene Fullname	autophagy related 14
Protein size	492
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Required for both basal and inducible autophagy. Determines the localization of the autophagy-specific PI3-kinase complex PI3KC3-C1. Plays a role in autophagosome formation and MAP1LC3/LC3 conjugation to phosphatidylethanolamine. Promotes BECN1 translocation from the trans-Golgi network to autophagosomes. Enhances PIK3C3 activity in a BECN1-dependent manner. Essential for the autophagy-dependent phosphorylation of BECN1. Stimulates the phosphorylation of BECN1, but suppresses the phosphorylation PIK3C3 by AMPK. Binds to STX17-SNAP29 binary t-SNARE complex on autophagosomes and primes it for VAMP8 interaction to promote autophagosome-endolysosome fusion. Modulates the hepatic lipid metabolism.
Nucleotide accession_num	NM_014924.4
Protein accession_num	NP_055739.2
Protein name	beclin 1-associated autophagy-related key regulator
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ATG14
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern