« Zurück
Startseite /
MPP6 Antibody - middle region

MPP6 Antibody - middle region

ArtNr	ARP82302_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Neuroscience Metabolism Diabetes Neural Signaling Antibodies Cell Biology Obesity Cell Status Necrosis Apoptosis Western Blot ELISA Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	TSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSI
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MPP6,VAM1,p55T,VAM-1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	59 kDa
Species Tested	Human
Gene symbol	MPP6
Gene Fullname	membrane protein, palmitoylated 6
Protein size	540
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily.
Nucleotide accession_num	NM_001303037.1
Protein accession_num	NP_057531.2
Protein name	MAGUK p55 subfamily member 6
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MPP6
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern