« Zurück
Startseite /
ACOT8 Antibody - C-terminal region

ACOT8 Antibody - C-terminal region

ArtNr	ARP82941_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Aging & Neurological Disorders Antibodies By Cell Type Carcinoma Hematology Leukemia Lymphoma Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	HRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	hTE,NAP1,PTE1,PTE2,PTE-1,PTE-2,HNAACTE,hACTE-III
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	319
Species Tested	Human
Gene symbol	ACOT8
Gene Fullname	ACOT8
Protein size	35
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells.
Nucleotide accession_num	NM_005469.3
Protein accession_num	NP_005460.2
Protein name	acyl-coenzyme A thioesterase 8
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human ACOT8
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern