« Zurück
Startseite /
FABP3 Antibody - N-terminal region

FABP3 Antibody - N-terminal region

ArtNr	ARP89812_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Antibodies Cell Biology Obesity Cell Status Necrosis Immunohistochemistry Western Blot Lipid & Fatty Acid Transport Primary Antibodies By Organ Breast Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	SKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEI
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Fab,Mdg,Fabp,H-FA,Mdgi,Fabph,Fabph1,Fabph4,H-FABP,Fabph-1,Fabph-4
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cell Biology, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	14 kDa
Gene symbol	FABP3
Gene Fullname	fatty acid binding protein 3, muscle and heart
Protein size	133
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Nucleotide accession_num	NM_010174.1
Protein accession_num	NP_034304.1
Protein name	fatty acid-binding protein, heart
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse FABP3
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 30.10.2025