Vergleich

IGF2BP3 Antibody - middle region

ArtNr ARP90710_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Sequence LIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQFEQSETETVHLFIP
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IM,IMP3,Koc1,IMP-3,Koc13,mimp3,Neilsen,AA522010,AL022933,AU045931,2610101N11Rik
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
64 kDa
Gene symbol
IGF2BP3
Gene Fullname
insulin-like growth factor 2 mRNA binding protein 3
Protein size
579
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
RNA-binding factor that may recruit target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Binds to the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes cell adhesion and invadopodia formation (By similarity). Binds to beta-actin/ACTB and MYC transcripts (By similarity). Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs.
Nucleotide accession_num
NM_023670.3
Protein accession_num
NP_076159.3
Protein name
insulin-like growth factor 2 mRNA-binding protein 3
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse IGF2BP3
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen