« Zurück
Startseite /
PLCG1 Antibody (Phospho-Tyr783)

PLCG1 Antibody (Phospho-Tyr783)

ArtNr	OAAF07335
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Neural Signaling Neural Adhesion Molecules Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Astrocytoma Immunostaining Calcium Binding Protein Markers Interneuron Markers
Typ	Antibody Polyclonal
Applikationen	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Monkey (Cynomolgus, Simian)
Host	Rabbit
Sequence	KLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	1-phosphatidyl-D-myo-inositol-4,5-bisphosphate;1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1;inositoltrisphosphohydrolase;monophosphatidylinositol phosphodiesterase;NCKAP3;phosphatidylinositol phospholipase C;phosphoinositidase C;phosphoinositide phospholipase C;phosphoinositide phospholipase C-gamma-1;phospholipase C,gamma 1 (formerly subtype 148);phospholipase C-148;Phospholipase C-gamma-1;phospholipase C-II;PLC1;PLC148;PLC-148;PLCgamma1;PLC-gamma-1;PLC-II;triphosphoinositide phosphodiesterase.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	148 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:10000
Gene symbol	PLCG1
Gene Fullname	phospholipase C gamma 1
Reconstitution and storage	-20°C
Description of target	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1, 4, 5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.
Protein name	1-phosphatidylinositol 4, 5-bisphosphate phosphodiesterase gamma-1
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyr783.
Manufacturer - Specificity	PLCG1 (Phospho-Tyr783) Antibody detects endogenous levels of PLCG1 only when phosphorylated at Tyr783.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF07335-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern