« Zurück
Startseite /
FAS Antibody (Phospho-Tyr291)

FAS Antibody (Phospho-Tyr291)

ArtNr	OAAF07562
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism Antibodies By Cell Type Carcinoma Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis ELISA Immunofluorescence Immunocytochemistry Cardiovascular Research Ischemia & Reperfusion Injury Enzymes Fatty Acid Synthesis Primary Antibodies Immunostaining Dot Blot Immunochemistry
Typ	Antibody Polyclonal
Applikationen	IF, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	AKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ALPS1A;APO-1;Apo-1 antigen;APO-1 cell surface antigen;apoptosis antigen 1;apoptosis signaling receptor FAS;apoptosis-mediating surface antigen FAS;APT1;CD95;CD95 antigen;Fas (TNF receptor superfamily,member 6);Fas AMA;FAS1;FASLG receptor;FASTM;mutant tumor necrosis receptor superfamily member 6;TNF receptor superfamily member 6;TNFRSF6;tumor necrosis factor receptor superfamily member 6;tumor necrosis factor receptor superfamily,member 6.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	37 kDa
Manufacturer - Application Additional Information	IF: 1:100~1:500 ELISA: 1:1000
Gene symbol	FAS
Gene Fullname	Fas cell surface death receptor
Reconstitution and storage	-20°C
Description of target	Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
Protein name	Tumor necrosis factor receptor superfamily member 6
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human FAS around the phosphorylation site of Tyr291.
Manufacturer - Specificity	FAS (Phospho-Tyr291) Antibody detects endogenous levels of FAS only when phosphorylated at Tyr291.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF07562-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern