« Zurück
Startseite /
IL-4R/CD124 Antibody (Phospho-Tyr497)

IL-4R/CD124 Antibody (Phospho-Tyr497)

ArtNr	OAAF07610
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Neural Signaling Neural Adhesion Molecules Antibodies By Cell Type Carcinoma Hematology Leukemia Lymphoma Melanoma Cell Biology Cell Culture Cytokines Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Endocrine Regulation of Lipid Metabolism Primary Antibodies Immunostaining Neuronal Cell Markers Immunochemistry
Typ	Antibody Polyclonal
Applikationen	WB, IF, IHC, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	QPLHLEPSPPASPTQSPDNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CD124;IL-4 receptor subunit alpha;IL4R nirs variant 1;IL4RA;IL-4RA;interleukin 13 receptor;interleukin-4 receptor alpha chain;interleukin-4 receptor subunit alpha.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunocytochemistry\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	89 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 IF: 1:100~1:500 ELISA: 1:1000
Gene symbol	IL4R
Gene Fullname	interleukin 4 receptor
Reconstitution and storage	-20°C
Description of target	Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Protein name	Interleukin-4 receptor subunit alpha
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human IL-4R/CD124 around the phosphorylation site of Tyr497.
Manufacturer - Specificity	IL-4R/CD124 (Phospho-Tyr497) Antibody detects endogenous levels of IL-4R/CD124 only when phosphorylated at Tyr497.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF07610-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 20 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern