« Zurück
Startseite /
GFAP Antibody (Phospho-Ser38)

GFAP Antibody (Phospho-Ser38)

ArtNr	OAAF07655
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Blastoma Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Neurodegeneration Markers Microglia Markers Immunochemistry
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IF, IHC, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	RRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ALXDRD;glial fibrillary acidic protein.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunocytochemistry\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Manufacturer - Targets	Human:S38
Shipping Temperature	Wet Ice
Molecular Weight	49 kDa
Manufacturer - Application Additional Information	WB: 1:500~1000 IHC: 1:50~100 IF: 1:100~500 ELISA: 1:5000
Gene symbol	GFAP
Gene Fullname	glial fibrillary acidic protein
Product format	LiquidPBS (without Mg²⁺ and Ca²⁺) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
Reconstitution and storage	-20°C
Description of target	GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
Protein name	Glial fibrillary acidic protein
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human GFAP around the phosphorylation site of Ser38.
Manufacturer - Specificity	GFAP (Phospho-Ser38) Antibody detects endogenous levels of GFAP only when phosphorylated at Ser38.
Concentration	1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF07655-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 20 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern