Vergleich

ATF2 Antibody (Phospho-Thr73 or 55)

ArtNr OAAF07680
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, IP, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence DHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELA
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Activating transcription factor 2;activating transcription factor 2 splice variant ATF2-var2;cAMP response element-binding protein CRE-BP1;cAMP responsive element binding protein 2,formerly;cAMP-dependent transcription factor ATF-2;CREB2;CREB-2;CRE-BP1;cyclic AMP-dependent transcription factor ATF-2;cyclic AMP-responsive element-binding protein 2;HB16;histone acetyltransferase ATF2;TREB7.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
52 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:20000
Gene symbol
ATF2
Gene Fullname
activating transcription factor 2
Reconstitution and storage
-20°C
Description of target
Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA-3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA-3'). In the nucleus, contributes to global transcription and the DNA damage response, in addition to specific transcriptional activities that are related to cell development, proliferation and death. In the cytoplasm, interacts with and perturbs HK1- and VDAC1-containing complexes at the mitochondrial outer membrane, thereby impairing mitochondrial membrane potential, inducing mitochondrial leakage and promoting cell death. The phosphorylated form (mediated by ATM) plays a role in the DNA damage response and is involved in the ionizing radiation (IR)-induced S phase checkpoint control and in the recruitment of the MRN complex into the IR-induced foci (IRIF). Exhibits histone acetyltransferase (HAT) activity which specifically acetylates histones H2B and H4 in vitro. In concert with CUL3 and RBX1, promotes the degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. Can elicit oncogenic or tumor suppressor activities depending on the tissue or cell type.
Protein name
Cyclic AMP-dependent transcription factor ATF-2
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human ATF2 around the phosphorylation site of Thr73 or 55.
Manufacturer - Specificity
ATF2 (Phospho-Thr73 or 55) Antibody detects endogenous levels of ATF2 only when phosphorylated at Thr73 or 55.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen