Vergleich

ATF4 Antibody (Phospho-Ser245)

ArtNr OAAF07681
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence DTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPY
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Activating transcription factor 4;cAMP response element-binding protein 2;cAMP-dependent transcription factor ATF-4;cAMP-responsive element-binding protein 2;CREB2;CREB-2;cyclic AMP-dependent transcription factor ATF-4;cyclic AMP-responsive element-binding protein 2;DNA-binding protein TAXREB67;TAXREB67;tax-responsive enhancer element B67;tax-responsive enhancer element-binding protein 67;TXREB.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
38 kDa
Manufacturer - Application Additional Information
WB: 1:500~2000IHC: 1/100 - 1/300ELISA: 1/10000
Gene symbol
ATF4
Gene Fullname
activating transcription factor 4
Product format
Liquid PBS containing 50% glycerol, 0.5% BSA, and 0.02% sodium azide
Reconstitution and storage
Store at -20°C for 1 year.
Description of target
Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production (By similarity). It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to endoplasmic reticulum (ER) stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors (PubMed:26086088).
Protein name
Cyclic AMP-dependent transcription factor ATF-4
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Immunogen
The antiserum was produced against synthesized peptide derived from human ATF4 around the phosphorylation site of Ser245. AA range:212-261
Manufacturer - Specificity
Phospho-CREB-2 (S245) Polyclonal Antibody detects endogenous levels of CREB-2 protein only when phosphorylated at S245.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
Zuletzt angesehen
 
Schließen