ITGAD Antibody

ArtNr	OAAF08091
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neuroinflammation Antibodies Cell Biology Cell Movement Cell Adhesion Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Typ	Antibody Polyclonal
Applikationen	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	NNKASSSKATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEH
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ADB2;beta-2 integrin alphaD subunit;CD11 antigen-like family member D;CD11D;integrin alpha-D;leukointegrin alpha D.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	126 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 ELISA: 1:10000
Gene symbol	ITGAD
Gene Fullname	integrin subunit alpha D
Reconstitution and storage	-20°C
Description of target	Integrin alpha-D/beta-2 is a receptor for ICAM3 and VCAM1. May play a role in the atherosclerotic process such as clearing lipoproteins from plaques and in phagocytosis of blood-borne pathogens, particulate matter, and senescent erythrocytes from the blood.
Protein name	Integrin alpha-D
Clonality	Polyclonal
Purification	The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from the Internal region of human ITGAD.
Manufacturer - Specificity	ITGAD Antibody detects endogenous levels of ITGAD protein.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF08091-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 20 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern