Vergleich

CMTM6 Antibody

ArtNr OAAF08167
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence TSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEP
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias chemokine-like factor super family 6;chemokine-like factor superfamily 6;chemokine-like factor superfamily member 6;CKLF-like MARVEL transmembrane domain-containing protein 6;CKLFSF6;PRO2219.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
20 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
ELISA: 1:10000
Gene symbol
CMTM6
Gene Fullname
CKLF like MARVEL transmembrane domain containing 6
Reconstitution and storage
-20°C
Description of target
Master regulator of recycling and plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity. Associates with both constitutive and IFNG-induced PD-L1/CD274 at recycling endosomes, where it protects PD-L1/CD274 from being targeted for lysosomal degradation, likely by preventing its STUB1-mediated ubiquitination. May stabilize PD-L1/CD274 expression on antigen presenting cells and potentiates inhibitory signaling by PDCD1/CD279, its receptor on T-cells, ultimately triggering T-cell anergy.
Protein name
CKLF-like MARVEL transmembrane domain-containing protein 6
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from the C-terminal region of human CMTM6.
Manufacturer - Specificity
CMTM6 Antibody detects endogenous levels of CMTM6 protein.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen