Vergleich

BCL6 Antibody

ArtNr OAAF08170
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB, IF, IHC, ICC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence SDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPN
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias B cell CLL/lymphoma 6;B-cell lymphoma 5 protein;B-cell lymphoma 6 protein;B-cell lymphoma 6 protein transcript;BCL5;BCL-5;BCL-6;BCL6A;cys-his2 zinc finger transcription factor;LAZ3;lymphoma-associated zinc finger gene on chromosome 3;protein LAZ-3;ZBTB27;zinc finger and BTB domain-containing protein 27;zinc finger protein 51;zinc finger transcription factor BCL6S;ZNF51.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
78 kDa
Manufacturer - Application Additional Information
WB: 1:500~1000
ELISA: 1:10000
Gene symbol
BCL6
Gene Fullname
BCL6 transcription repressor
Product format
Liquid PBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
Reconstitution and storage
-20°C
Description of target
Transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation which has different mechanisms of action specific to the lineage and biological functions. Forms complexes with different corepressors and histone deacetylases to repress the transcriptional expression of different subsets of target genes. Represses its target genes by binding directly to the DNA sequence 5'-TTCCTAGAA-3' (BCL6-binding site) or indirectly by repressing the transcriptional activity of transcription factors. In GC B-cells, represses genes that function in differentiation, inflammation, apoptosis and cell cycle control, also autoregulates its transcriptional expression and up-regulates, indirectly, the expression of some genes important for GC reactions, such as AICDA, through the repression of microRNAs expression, like miR155. An important function is to allow GC B-cells to proliferate very rapidly in response to T-cell dependent antigens and tolerate the physiological DNA breaks required for immunglobulin class switch recombination and somatic hypermutation without inducing a p53/TP53-dependent apoptotic response. In follicular helper CD4(+) T-cells (T(FH) cells), promotes the expression of T(FH)-related genes but inhibits the differentiation of T(H)1, T(H)2 and T(H)17 cells. Also required for the establishment and maintenance of immunological memory for both T- and B-cells. Suppresses macrophage proliferation through competition with STAT5 for STAT-binding motifs binding on certain target genes, such as CCL2 and CCND2. In response to genotoxic stress, controls cell cycle arrest in GC B-cells in both p53/TP53-dependedent and -independent manners. Besides, also controls neurogenesis through the alteration of the composition of NOTCH-dependent transcriptional complexes at selective NOTCH targets, such as HES5, including the recruitment of the deacetylase SIRT1 and resulting in an epigenetic silencing leading to neuronal differentiation.
Protein name
B-cell lymphoma 6 protein
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from the Internal region of human BCL6.
Manufacturer - Specificity
BCL6 Antibody detects endogenous levels of BCL6 protein.
Concentration
1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen