Vergleich

AUH Antibody

ArtNr OAAL00023
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, ELISA
Clon 2G12
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2a Kappa
Sequence RAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPG
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias 3-methylglutaconyl-CoA hydratase;AU RNA binding protein/enoyl-CoA hydratase;AU RNA-binding protein/enoyl-Coenzyme A hydratase;AU-binding protein/Enoyl-CoA hydratase;AU-specific RNA-binding enoyl-CoA hydratase;itaconyl-CoA hydratase;methylglutaconyl-CoA hydratase,mitochondrial.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
AUH
Gene Fullname
AU RNA binding methylglutaconyl-CoA hydratase
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form. [provided by RefSeq
Nucleotide accession_num
NM_001698
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/NP_001689
Protein name
Homo sapiens AU RNA binding methylglutaconyl-CoA hydratase (AUH), transcript variant 1, mRNA|methylglutaconyl-CoA hydratase, mitochondrial isoform 1 precursor [Homo sapiens]
Clonality
Monoclonal
Immunogen
AUH (NP_001689, 44 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen