CEBPG Antibody

ArtNr	OAAL00045
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Lineage Markers Neural Transcription Factors Neural Signaling Antibodies Immunohistochemistry Immunoprecipitation Western Blot ELISA Primary Antibodies Immunostaining Neuronal Cell Markers
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IP, ELISA
Clon	S2
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	c/EBP gamma;CCAAT/enhancer binding protein (C/EBP),gamma;CCAAT/enhancer-binding protein gamma;GPE1BP;IG/EBP-1.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	CEBPG
Gene Fullname	CCAAT enhancer binding protein gamma
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. [provided by RefSeq
Nucleotide accession_num	BC013128
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH13128
Protein name	CCAAT/enhancer binding protein (C/EBP), gamma [Homo sapiens]\|Homo sapiens CCAAT/enhancer binding protein (C/EBP), gamma, mRNA (cDNA clone MGC:5089 IMAGE:3445301), complete cds
Clonality	Monoclonal
Immunogen	CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00045-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern