ELK1 Antibody

ArtNr	OAAL00091
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Lineage Markers Neural Transcription Factors Neural Signaling Antibodies ELISA Primary Antibodies Immunostaining Neuronal Cell Markers
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	ELISA
Clon	2G6
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ELK1,ETS transcription factor;ELK1,member of ETS oncogene family;ETS domain-containing protein Elk-1;ETS-like gene 1;tyrosine kinase (ELK1) oncogene.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Proximity ligation assay
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	ELK1
Gene Fullname	ETS transcription factor ELK1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Nucleotide accession_num	NM_005229
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005220
Protein name	ETS domain-containing protein Elk-1 isoform a [Homo sapiens]\|Homo sapiens ELK1, ETS transcription factor (ELK1), transcript variant 2, mRNA
Clonality	Monoclonal
Immunogen	ELK1 (NP_005220, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00091-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern