Vergleich

HRH1 Antibody

ArtNr OAAL00150
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen ELISA
Clon 3D1
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG1 Kappa
Sequence AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias H1R;H1-R;HH1R;hisH1;histamine H1 receptor;histamine receptor,subclass H1.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Proximity ligation assay
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
HRH1
Gene Fullname
histamine receptor H1
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless until recently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Nucleotide accession_num
NM_000861
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/NP_000852.1
Protein name
histamine H1 receptor [Homo sapiens]|Homo sapiens histamine receptor H1 (HRH1), transcript variant 4, mRNA
Clonality
Monoclonal
Immunogen
HRH1 (NP_000852.1, 312 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen