MCM6 Antibody

ArtNr	OAAL00190
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Lineage Markers Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IF, ELISA
Clon	7D8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	DNA replication licensing factor MCM6;MCG40308;MCM6 minichromosome maintenance deficient 6 (MIS5 homolog,S. pombe);minichromosome maintenance deficient (mis5,S. pombe) 6;Mis5;P105MCM.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MCM6
Gene Fullname	minichromosome maintenance complex component 6
Product format	Liquid 1X PBS (pH 7.4)
Reconstitution and storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication. [provided by RefSeq
Nucleotide accession_num	NM_005915.4
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005906.2
Protein name	DNA replication licensing factor MCM6 [Homo sapiens]\|Homo sapiens minichromosome maintenance complex component 6 (MCM6), mRNA
Clonality	Monoclonal
Immunogen	MCM6 (NP_005906.2, 1 a.a. ~ 821 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4
Concentration	1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00190-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern