NDUFB7 Antibody

ArtNr	OAAL00211
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	4D4
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	B18;cell adhesion protein SQM1;CI-B18;complex I B18 subunit;complex I-B18;NADH dehydrogenase (ubiquinone) 1 beta subcomplex,7,18kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7;NADH-ubiquinone oxidoreductase B18 subunit.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	NDUFB7
Gene Fullname	NADH:ubiquinone oxidoreductase subunit B7
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
Nucleotide accession_num	NM_004146
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_004137
Protein name	Homo sapiens NADH:ubiquinone oxidoreductase subunit B7 (NDUFB7), mRNA\|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Homo sapiens]
Clonality	Monoclonal
Immunogen	NDUFB7 (NP_004137, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00211-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern