PLGLB2 Antibody

ArtNr	OAAL00246
Hersteller	AVIVA Systems Biology
Menge	50 ug
Kategorie	Neuroscience Protein Aggregation, Clearance & Misfolding Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IF, IHC, ELISA
Clon	3000000
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	PLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	plasminogen pseudogene 1;Plasminogen-like protein A;Plasminogen-like protein A1;plasminogen-like protein B;plasminogen-related protein A;plasminogen-related protein B;PLGLA;PLGLA1;PLGP1;PLGP2;PRGA;type B plasminogen related.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	PLGLB2
Gene Fullname	plasminogen like B2
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_002665
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_002656
Protein name	Homo sapiens plasminogen-like B2 (PLGLB2), mRNA\|plasminogen-like protein B precursor [Homo sapiens]
Clonality	Monoclonal
Immunogen	PLGLB2 (NP_002656, 21 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00246-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern