EIF1AY Antibody

ArtNr	OAAL00434
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Melanoma Sarcoma Adenocarcinoma Mesothelioma Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IF, ELISA
Clon	1B4
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	eIF-4C;eukaryotic translation initiation factor 1A,Y chromosome;eukaryotic translation initiation factor 1A,Y-chromosomal;eukaryotic translation initiation factor 4C.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	EIF1AY
Gene Fullname	eukaryotic translation initiation factor 1A Y-linked
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq
Nucleotide accession_num	BC005248
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_004672.2
Protein name	eukaryotic translation initiation factor 1A, Y-chromosomal isoform 1 [Homo sapiens]\|Homo sapiens eukaryotic translation initiation factor 1A, Y-linked, mRNA (cDNA clone MGC:12282 IMAGE:3933718), complete cds
Clonality	Monoclonal
Immunogen	EIF1AY (NP_004672.2, 22 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00434-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern