Vergleich

MED7 Antibody

ArtNr OAAL00452
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, ELISA
Clon 2D7
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG2b
Sequence MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias activator-recruited cofactor 34 kDa component;ARC34;cofactor required for Sp1 transcriptional activation subunit 9;cofactor required for Sp1 transcriptional activation,subunit 9 (33kD);cofactor required for Sp1 transcriptional activation,subunit 9,33kDa;CRSP complex subunit 9;CRSP33;CRSP9;mediator of RNA polymerase II transcription subunit 7;RNA polymerase transcriptional regulation mediator subunit 7 homolog;transcriptional coactivator CRSP33.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
MED7
Gene Fullname
mediator complex subunit 7
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Nucleotide accession_num
BC005250
Protein accession_num
AAH05250
Protein name
Homo sapiens mediator complex subunit 7, mRNA (cDNA clone IMAGE:3961736)
Clonality
Monoclonal
Immunogen
CRSP9 (AAH05250, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen