BAG4 Antibody

ArtNr	OAAL00462
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Antibodies By Cell Type Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	2G9
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTYPPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRY
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	BAG family molecular chaperone regulator 4;BAG-4;BCL2 associated athanogene 4;bcl-2-associated athanogene 4;silencer of death domains;SODD.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	BAG4
Gene Fullname	BAG cochaperone 4
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. [provided by RefSeq
Nucleotide accession_num	BC038505
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH38505
Protein name	BCL2-associated athanogene 4 [Homo sapiens]\|Homo sapiens BCL2-associated athanogene 4, mRNA (cDNA clone MGC:33671 IMAGE:5259771), complete cds
Clonality	Monoclonal
Immunogen	BAG4 (AAH38505, 1 a.a. ~ 457 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00462-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern