EPM2AIP1 Antibody

ArtNr	OAAL00478
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Targets for Rodent Neurosciences Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	5G7
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	EPM2A (laforin) interacting protein 1;EPM2A-interacting protein 1;laforin-interacting protein.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	EPM2AIP1
Gene Fullname	EPM2A interacting protein 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The EPM2A gene, which encodes laforin, is mutated in an autosomal recessive form of adolescent progressive myoclonus epilepsy. The protein encoded by this gene binds to laforin, but its function is not known. This gene is intronless. [provided by RefSeq
Nucleotide accession_num	NM_014805
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_055620
Protein name	EPM2A-interacting protein 1 [Homo sapiens]\|Homo sapiens EPM2A interacting protein 1 (EPM2AIP1), mRNA
Clonality	Monoclonal
Immunogen	EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00478-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern