ARPC3 Antibody

ArtNr	OAAL00493
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Antibodies Cell Biology Cytoskeleton Western Blot ELISA Primary Antibodies Microfilaments Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	200000000000
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISEC
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	actin related protein 2/3 complex,subunit 3,21kDa;actin-related protein 2/3 complex subunit 3;ARC21;arp2/3 complex 21 kDa subunit;ARP2/3 protein complex subunit p21;p21-Arc.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	ARPC3
Gene Fullname	actin related protein 2/3 complex subunit 3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined. [provided by RefSeq
Nucleotide accession_num	NM_005719
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005710.1
Protein name	actin-related protein 2/3 complex subunit 3 [Homo sapiens]\|Homo sapiens actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), mRNA
Clonality	Monoclonal
Immunogen	ARPC3 (NP_005710.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00493-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern