WASF2 Antibody

ArtNr	OAAL00500
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot ELISA Primary Antibodies By Organ Breast Cancer Immunostaining small GTPases Rho Subfamily
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	1F7
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	dJ393P12.2;IMD2;protein WAVE-2;putative Wiskott-Aldrich syndrome protein family member 4;SCAR2;suppressor of cyclic-AMP receptor (WASP-family);verprolin homology domain-containing protein 2;WAS protein family member 2;WASF4;WASP family protein member 2;WASP family protein member 4;WASP family Verprolin-homologous protein 2;WAVE2;wiskott-Aldrich syndrome protein family member 2.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	WASF2
Gene Fullname	WASP family member 2
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. [provided by RefSeq
Nucleotide accession_num	NM_006990
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_008921
Protein name	Homo sapiens WAS protein family member 2 (WASF2), transcript variant 1, mRNA\|wiskott-Aldrich syndrome protein family member 2 isoform 1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	WASF2 (NP_008921, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern