BCL2L14 Antibody

ArtNr	OAAL00811
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Cell Biology Cell Status Apoptosis Immunoprecipitation Western Blot ELISA Autophagy Primary Antibodies By Organ Colorectal Cancer Testicular & Prostate Cancer Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IP, ELISA
Clon	1D11
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLM
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	apoptosis facilitator Bcl-2-like protein 14;apoptosis regulator BCL-G;bcl2-L-14;BCL2-like 14 (apoptosis facilitator);BCLG;testicular tissue protein Li 26.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	BCL2L14
Gene Fullname	BCL2 like 14
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq
Nucleotide accession_num	BC025778
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH25778.1
Protein name	BCL2-like 14 (apoptosis facilitator) [Homo sapiens]\|Homo sapiens BCL2-like 14 (apoptosis facilitator), mRNA (cDNA clone MGC:34131 IMAGE:5222875), complete cds
Clonality	Monoclonal
Immunogen	BCL2L14 (AAH25778.1, 1 a.a. ~ 327 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00811-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern