MAP1LC3B Antibody

ArtNr	OAAL00836
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Lineage Markers Protein Aggregation, Clearance & Misfolding Antibodies Cell Biology Cell Status Immunohistochemistry Western Blot ELISA Autophagy Primary Antibodies Immunostaining Glial Cell Markers Astroglia Markers
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	ELISA
Clon	400000000000
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ATG8F;autophagy-related ubiquitin-like modifier LC3 B;LC3B;MAP1 light chain 3-like protein 2;MAP1A/1BLC3;MAP1A/MAP1B LC3 B;MAP1A/MAP1B light chain 3 B;MAP1LC3B-a;microtubule-associated proteins 1A/1B light chain 3B.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MAP1LC3B
Gene Fullname	microtubule associated protein 1 light chain 3 beta
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq
Nucleotide accession_num	NM_022818
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_073729
Protein name	Homo sapiens microtubule associated protein 1 light chain 3 beta (MAP1LC3B), mRNA\|microtubule-associated proteins 1A/1B light chain 3B [Homo sapiens]
Clonality	Monoclonal
Immunogen	MAP1LC3B (NP_073729, 1 a.a. ~ 71 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00836-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern