PPARG Antibody

ArtNr	OAAN00069
Hersteller	AVIVA Systems Biology
Menge	50 ul
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Antibodies By Cell Type Carcinoma Immunohistochemistry Western Blot ELISA Immunofluorescence Cardiovascular Research Atherosclerosis Primary Antibodies Other Lipid\Cholesterol Metabolism Modulators
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IF, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GLM1,CIMT1,NR1C3,PPARG1,PPARG2,PPARG5,PPARgamma
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	58 kDa
Manufacturer - Application Additional Information	WB: 1:500~2000 IHC: 1:50~200 IF: 1:50~200
Gene symbol	PPARG
Gene Fullname	peroxisome proliferator activated receptor gamma
Product format	Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage	Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target	This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.
Nucleotide accession_num	NM_005037.5
Protein accession_num	NP_005028.4
Protein name	Peroxisome proliferator-activated receptor gamma
Clonality	Polyclonal
Purification	Affinity purified against immunogen
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARG (NP_056953.2).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAN00069-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern