Vergleich

RBBP7 Antibody

ArtNr OAAN02075
Hersteller AVIVA Systems Biology
Menge 50 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB, IF, IP, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Sequence MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVE
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RbAp46
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
48 kDa
Manufacturer - Application Additional Information
WB: 1:500~2000
IF: 1:50~100
IP: 1:50~200
CHIP: 1:50~200
Gene symbol
RBBP7
Gene Fullname
retinoblastoma binding protein 7
Product format
Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage
Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target
This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num
NM_001198719.1
Protein accession_num
NP_001185648.1
Protein name
Histone-binding protein RBBP7
Clonality
Polyclonal
Purification
Affinity purified against immunogen
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 (NP_002884.1).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen