Vergleich

LIVER FABP Antibody - N-terminal region (OABB02069)

ArtNr OABB02069
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IHC-P
Specific against other
Host Rabbit
Isotype IgG
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Lieferbar
Gene symbol
LIVER FABP
Product format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Gene id
2168
Reconstitution and storage
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Description of target
Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.
Purification
Immunogen affinity purified.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen