« Zurück
Startseite /
Rab11b Antibody - C-terminal

Rab11b Antibody - C-terminal

ArtNr	ARP72410_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Antibodies Cell Biology Cytoskeleton Western Blot Primary Antibodies small GTPases Rab Subfamily
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Rat (Rattus norvegicus)
Host	Rabbit
Sequence	KNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCC
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	23 kDa
Species Tested	Rat
Gene symbol	RAB11B
Gene Fullname	RAB11B, member RAS oncogene family
Protein size	218
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	may be involved in osteoclast motility and membrane turnover [RGD, Feb 2006]
Protein accession_num	NP_116006.1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen for Anti-Rab11b antibody is: synthetic peptide directed towards the C-terminal of Rat RB11B
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern