Vergleich

Trypsin Porcine

ArtNr OOPA00226
Hersteller AVIVA Systems Biology
Menge 1 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
Host Pichia Pastoris
Sequence VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products Trypsin
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Others
Manufacturer - Category
Root Catalog/Products/Other, Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Wet Ice
Manufacturer - Application Additional Information
Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w)
Gene symbol
TRYPSIN
Protein size
Recombinant
Product format
Lyophilized with mannitol as a preservative.
Physical Appearance: Sterile filtered white powder
Reconstitution and storage
It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Description of target
Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
Purification
Purified by standard chromatography techniques.
Biological activity
4, 500 USP units/mg protein.
Unit Definition: One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0 ml at pH 7.6 and 25° C, with BAEE as a substrate (1 cm light path).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen