OSTalpha (organic solute transporter alpha) Blocking Peptide (the middle region of OSTalpha)(100ug)

Hersteller AVIVA Systems Biology
Kategorie
Typ Peptides
Specific against other
Format Lyophilized powder
Menge 100ug
ArtNr AAP53102
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
description
This is a synthetic peptide designed for use in combination with anti-OSTalpha Antibody(ARP53102_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
gene_symbol
OSTalpha
nucleotide_accession_num
http://www.ncbi.nlm.nih.gov/nuccore/NM_152672
protein_accession_num
http://www.ncbi.nlm.nih.gov/protein/NP_689885
swissprot_id
http://www.uniprot.org/uniprot/Q86UW1
protein_size
340
molecular_weight
38kDa
subunit
alpha
product_format
Lyophilized powder
gene_id
200931
peptide_sequence
LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
reconstitution_and_storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
partner_proteins
ATXN1
description_of_target
OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.OSTalpha efficiently transports the major species of bile acids.
Menge: 100ug
Lieferbar: In stock
Listenpreis: 106,72 €
Preis: 106,72 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen