GCSAML (germinal center-associated, signaling and motility-like ) Blocking Peptide (the N terminal of GCSAML)(100ug)

Hersteller AVIVA Systems Biology
Kategorie
Typ Peptides
Specific against Human
Format Lyophilized powder
Applikationen WB
Menge 100ug
ArtNr AAP69363
Eclass 6.1 34160400
Eclass 9.0 32160409
Lieferbar
Description
This is a synthetic peptide designed for use in combination with anti-GCSAML Antibody (ARP69363_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Gene symbol
GCSAML
Protein size
135
Molecular weight
14kDa
Gene_id
148823
Peptide sequence
ENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQ EVSSTSNQENENGSG
Reconstitution and storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°, C. Avoid repeat freeze-thaw cycles.
Description of target
The function of this protein remains unknown.
Menge: 100ug
Lieferbar: In stock
Listenpreis: 106,72 €
Preis: 106,72 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?

Ihr Ansprechpartner:

Arne Pelz

sales@hoelzel.de

 
Schließen