Vergleich

Recombinant human Carcinoembryonic antigen-related cell adhesion molecule 4

ArtNr OPCA01222
Hersteller AVIVA Systems Biology
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Citations Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias carcinoembryonic antigen CGM7;carcinoembryonic antigen gene family member 7;carcinoembryonic antigen related cell adhesion molecule 4;carcinoembryonic antigen-related cell adhesion molecule 4;carcinoembryonic antigen-related cell adhesion molecule 4-sv1;carcinoembryonic antigen-related cell adhesion molecule 4-sv2;CGM7;CGM7_HUMAN;NCA;Nonspecific cross-reacting antigen (NCA);nonspecific cross-reacting antigen W236;non-specific cross-reacting antigen W236.
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
14.7 kDa
Gene symbol
CEACAM4
Gene Fullname
CEA cell adhesion molecule 4
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Protein name
Carcinoembryonic antigen-related cell adhesion molecule 4
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen