Recombinant Baker's yeast Cystathionine gamma-lyase (OPCA01227)

Hersteller AVIVA Systems Biology
Kategorie
Typ Proteins
Specific against other
Menge 50ug
ArtNr OPCA01227
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Peptide sequence
TLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTF KQSSPANPIGTYEYSRSQNPNRENLERAVAALENA QYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGG THRYFTKVANAHGVETSFTNDLLNDLPQLIKENTK LVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSD VVLGVLATNNKPLYERLQFLQNAIGAIPSPFDAWL THRGLKTLHLRVRQAALSANKIAEFLAADKENVVA VNYPGLKTHPNYDVVLKQHRDALGGGMISFRIKGG AEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH GGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIK QALKQ
Reconstitution and storage
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Description of target
Recombinant Baker's yeast Cystathionine gamma-lyase
Purity
>90% (SDS-PAGE)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 50ug
Lieferbar: Out of stock
Fragen zum Produkt?
 
Schließen